PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g064760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 263aa    MW: 28681.2 Da    PI: 6.6308
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g064760.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.7e-2195150156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe +F+++++p++++r +L+++l+L+ rqVk+WFqNrR+++k
  Csa04g064760.1  95 KKRYHRHTPQQIQELELVFKECPHPDEKQRLDLSRRLNLDSRQVKFWFQNRRTQMK 150
                     688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-2180153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-2290158IPR009057Homeodomain-like
PROSITE profilePS5007117.00692152IPR001356Homeobox domain
SMARTSM003896.1E-1893156IPR001356Homeobox domain
PfamPF000461.0E-1895150IPR001356Homeobox domain
CDDcd000862.81E-1995150No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
SuperFamilySSF559611.13E-5148252No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MNFSGFLHHD DDNSSGGGND FSSAAMSGGL VKSIFSSPRL SLGLQQTNGE ATRTGESFEV  60
SVSRRSPESR SGSDNAEALS GDDDFDASDR PLKKKKRYHR HTPQQIQELE LVFKECPHPD  120
EKQRLDLSRR LNLDSRQVKF WFQNRRTQMK AMNANQSSML ILQETSIDAS GAVVVHAPVD  180
IPAMHSVMKG ADSAYVALLP SGFGILPDGQ GMEETGSLLT VAFQILVNSL PTAKLNVESI  240
ETVNNLISCT VQKIRAALRC DK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010507760.11e-109PREDICTED: homeobox-leucine zipper protein HDG1-like
SwissprotQ9M2E82e-54HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FVJ92e-95R0FVJ9_9BRAS; Uncharacterized protein
STRINGBra004934.1-P2e-77(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.16e-55homeodomain GLABROUS 1